<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2016 2016-30701 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   T12A, I13V, G16E, K20KT, L33V, E35D, N37Q, I62V, L63H, I64V  
>2016-30701| codons 4-99
TLWQRPLVAVKIEGQLTEALLDTGADNTVVEDMQLPGRWKPKMIGGIGGFIKVRQYDQVH
VEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V F77FL     V60I, V106I, K122E, I135T, T200A, E204D, R211K  
>2016-30701| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDLRELNKRTQDFWEVQLGIPHP
AGLKKKKSITVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIEDLRQHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006