<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2015 2015-30701 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, K70R, T215F D67H, K219Q K101EV, G190A   K43E, V60VI, S68SN, T69N, K122E, I135LV, E138EQ, K166R, H208HY, R211K  
>2015-30701| codons 38-247
CTELEEEGKISKIGPENPYNTPIFAIKKKHNNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLVKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNQTPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDIVIYQYMDDLYVASDLEIGQHRTKIEELRQYLLKWGFFTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L10F, V32A, L33F, K43T, N88D I13V, I15V, K20T, E35D, M36I, N37S, K45R, R57K, L63P, I64V, V77VI, L89LM  
>2015-30701| codons 4-99
TLWQRPFVTVKVGGQLTEALLDTGADNTAFEDISLPGRWTPRMIGGIGGFIKVKQYDQIP
VEICGHKAIGTVLIGPTPVNIIGRDMLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006