<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1820 1820-30822 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54A, V82A L10F, L24I I13M, K20I, M36I, R41K, Q61N, L63P, I64V, H69Y  
>1820-30822| codons 4-99
TLWQRPFVTMKIGGQLIEALIDTGADDTVLEEINLPGKWKPKIIGGIGGFAKVRQYDNIP
VEICGYKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L74V, M184V K219Q Y181C, G190GA   T39A, E40D, V60I, K122E, D123N, I178M, T200A, E203K, Q207E, V245K  
>1820-30822| codons 38-247
CADLEKEGKISKIGPENPYNTPIFAIKKKNSDRWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMVICQYVDDLYVASDLEIGQHRAKIKELREHLLRWGFTTP
DQKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006