<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1666 1666-30429 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I50V, I54V, V82A L10F, V11I, L33F, F53FL, G73S, L89V G16A, R41RK, K55R, R57K, D60E, L63P, G68GE, K70R, A71V  
>1666-30429| codons 4-99
TLWQRPFITIKIAGQLKEALLDTGADDTVFEEMNLPGKWKPKLIVGVGGLVRVKQYEQIP
IEICEHRVISTVLVGPTPANIIGRNVLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y D67G, K219N Y181C, G190A   E44D, K49Q, S68G, V90I, K122P, D123DE, I178IM, V179VI, H208HY  
>1666-30429| codons 38-247
CTELEKDGKISQIGPENPYNTPVFAIKKKGGTKWRKVVDFRELNKRTQDFWEIQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDPEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMIICQYMDDLYVASDLEIGQHRTKIEELRQYLWRWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006