<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1594 1594-30822 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74LI, T215Y V75M, K219N K103N, Y181YC, G190A   E40F, K43E, V118I, K122KE, D123EK, I202V, L210S, V245T I159IL
>1594-30822| codons 38-247
CTFLEEEGKISKIGPENPYNTPVFAIKKKNSTKWRKIMDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEKFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
ALFQSSMTKILEPFRKQNPDIVICQYMDDLYVASDLEIGQHRTKVEELRQHLSRWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPITLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, I84V, L90M L10F, Q58E K20R, E35D, M36I, N37S, R41RK, I62V, L63T, A71V, I72T, T74S, L89M, Q92K, I93L  
>1594-30822| codons 4-99
TLWQRPFVTIKIGGQLREALLDTGADDTVLEDISLPGKWKPKIIGGIGGFVKVREYDQVT
IEICGHKVTGSVLVGPTPVNVIGRNMMTKLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006