<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1589 1589-30617 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, L210W, T215Y   Y188L   K43E, V60I, A98S, K122E, G196E, T200TA, V245VI  
>1589-30617| codons 38-247
CTEMEEEGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLLVGSDLEIEQHRAKIEELRQHLWRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIILP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I47V, I54L, V82A, L90M L10F, V32I_R, G73GS, L89LV I15V, G16E, K20V, L63H, K70E, A71V, V77IL  
>1589-30617| codons 4-99
TLWQRPFVTIKVEGQLVEALLDTGADDTILEEMNLPGRWKPKMVGGIGGFLKVRQYDQIH
IEICGHEVISTVLLGPTPANIIGRNVMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006