<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2155 2155-30721 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, L74I, M184V, T215F K219Q K103N A98G V118I, K122E, I135T, I142V, K166R, F214L, L228H  
>2155-30721| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSDRWRKIVDFRELNKRTQDFWEVQLGIPHP
GGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFTP
DQKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V L10F, V11I, L33F, T74P I13V, I15V, K20T, E35D, M36I, R41K, K55R, I62V, L63P, L89T  
>2155-30721| codons 4-99
TLWQRPFITVKVGGQLTEALLDTGADDTVFEDINLPGKWKPKMIGGIGGFVRVRQYDQVP
IEICGHKAIGPVLVGPTPVNVIGRNTLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006