<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2150 2150-30818 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54LV, L76V, V82A L33F L10I, I13V, G16E, M36IV, K43KQ, K55R, D60E, Q61D, L63T, C67Y, I72T, T74TS, L89M P39P_EK
>2150-30818| codons 4-99
TLWQRPIVTVKIEGQLKEALLDTGADDTVFEEVNLPGRWQPKIIGGIGGFVRVRQYEDIT
IEIYGHKATGSVVVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, L74V, M184V, L210W, T215FY D67*EKQ, T69G, K219E Y181V V108I T39A, E40D, V60I, K66X, K102E, V118VI, K122E, I135T, T139TA, S162CY, V179I, T200TA, D218E, H221HY, L228H, Q242H  
>2150-30818| codons 38-247
CADLEKEGKISKIGPENPYNTPIFAIKKXQSGRWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKEKKSVTILDVGDAYFSIPLDEDFRKYTAFTIPSTNNEAPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDIIIVQYVDDLYVGSDLEIGQHRAKIEELRQHLWRWGFYTP
EEKYQKEPPFHWMGYELHPDKWTVHPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006