<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1808 CA7442 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 143
2 DDI 169
3 D4T+3TC+IDV 61
4 3TC+AZT+DDI+IDV 8
5 AZT+3TC+NVP+NFV 72

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73S L10I, I15V, K20I, M36I, R41K, I62V, L63P, I72L, I93L  
>CA7442| codons 1-99
PQITLWQRPIVTIKVGGQLIEALLDTGADDTVLEEINLPGKWKPKIIGGIGGFIKVRQYD
QVPIEICGHKALSTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V D67G     E6ED, K20R, E44D, S68G, V118VI, I135V, S162C, Q174QH, N175NY P140PQ
>CA7443| codons 1-193
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKGGTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSVNNETQGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKHYPDIVI
YQYVDDLYVGSDL

References
Author Title Citation
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009