<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1999 1999-30707 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    G190A A98G V60I, K122P, I142IV, D177E, V179VI, T200TA, R211K, F214L, P243PL N57NH
>1999-30707| codons 38-247
CTEMEKEGKISKIGPENPYHTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAYFSVPLDPDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIIIYQYMDDLYVASDLEIGQHRAKIEELRQHLLKWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQLIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, N37DE, D60E, I62IV, L63P, I64V, V77I  
>1999-30707| codons 4-99
TLWQRPLVTVKIGGQLKEALLDTGADDTVLEDMELPGRWKPKMIGGIGGFIKVRQYEQVP
VEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006