<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2362 2362-30821 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, L90M L10F, L89V I13V, M36I, N37S, R57K, I62V, L63P, A71T E35DY
>2362-30821| codons 4-99
TLWQRPFVTVKIGGQLKEALLDTGADDTILEYISLPGRWKPKIVGGIGGFLKVKQYDQVP
IEICGHKTIGTVLVGPTPVNIIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       K43N, V90I, V118I, K122E, S162Y, T200I, R211K  
>2362-30821| codons 38-247
CTELENEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRIKIEELRQHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006