<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2473 2473-30821 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69S_VG, M184V A62V, T215I K103S, G190GA A98G K122E, I178IM, T200TA, V245E  
>2473-30821| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKSKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMVIYQYVDDLYVASDLEIGQHRAKIEELRQHLLRWGFITP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M V11I, L33I, G73GA, L89V L10I, I13V, K20I, M36I, I62V, L63P, G68GE, H69HR, A71T, I72IT, V82I, I93L  
>2473-30821| codons 4-99
TLWQRPIITVKIGGQLIEALLDTGADDTVIEEINLPGRWKPKIIGGIGGFIKVRQYDQVP
IEICERKTTATVLVGPTPINVIGRNVMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006