<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1857 1857-30527 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, I84V L33F L10I, I13V, N37S, I62V, L63A, T74S, V77I, L89M, I93L  
>1857-30527| codons 4-99
TLWQRPIVTVKIGGQLKEALLDTGADDTVFEEMSLPGRWKPKMIGGIGGFLKVRQYDQVA
IEICGHKAIGSVLIGPTPVNVIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69T_XT, T215Y D67DE Y181C   S48T, K101Q, K122KE, I135V, E138EG, I178L, Q207E, R211K, L228R  
>1857-30527| codons 38-247
CTELEKEGKITKIGPENPYNTPVFAIKKKESTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNGTPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDLVICQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFYTP
DKKHQKEPPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006