<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2477 2477-30821 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69T_T, K70R, L74LV, M184V, L210W D67G, T215E, K219Q Y181C V108VI K64N, V111VI, V118VI, K122E, D123DG, I202V, E203K, R211K, F214FL, D218E  
>2477-30821| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAINKKGSTRWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTILDIGDAYFSIPLDEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVGSDLEIGQHRTKVKELRQHLWKWGLETP
EQKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M L10F, G73T K20I, E35D, M36I, N37Q, R57K, L63P, I64V, A71V, I72R, I85V  
>2477-30821| codons 4-99
TLWQRPFVTIKIGGQLIEALLDTGADDTVLEDIQLPGRWKPKMIGGIGGFVKVKQYDQIP
VEICGHKVRTTVLVGPTPVNVVGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006