<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2464 2464-30819 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V L10F, Q58E, G73T I13V, I15V, K20I, E35D, M36I, N37S, R41K, D60DN, I62V, L63P, I66IV, I72IL, I93L  
>2464-30819| codons 4-99
TLWQRPFVTVKVGGQLIEALLDTGADDTVLEDISLPGKWKPKIIGGIGGFVKVREYNQVP
IEVCGHKALTTVLVGPTPVNVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, L74I, M184V, L210W, T215Y K219R K103N A98G, V108I K43Q, V118I, K122E, D123N, I135L, D177G, Q207D, H208Y, R211K, K223E, L228H, V245K E203KR
>2464-30819| codons 38-247
CTELEQEGKISKIGPENPYNTPVFAIKKKDSDKWRKIVDFRELNKRTQDFWEVQLGIPHP
GGLKKNKSVTILDVGDAYFSIPLDENFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPGIVIYQYVDDLYVGSDLEIGQHRTKIRELRDYLWKWGFYTP
DRKHQEEPPFHWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006