<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2388 2388-30814 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69T_TT, M184MI, T215Y   G190A   S68T, W88C, K101Q, K103KR, K122KE, I142V, K173KR, R211K, V245T  
>2388-30814| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDTTKWRKLVDFRELNKRTQDFCEVQLGIPHP
AGLQKRKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRRQNPDIVIYQYIDDLYVASDLEIGQHRTKIEELRQHLLKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPITLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54M, V82A L33LF, Q58QE L10I, I13IV, E35D, M36I, R41K, I62V, L63P, A71AT, T74S  
>2388-30814| codons 4-99
TLWQRPIVTVKIGGQLKEALLDTGADDTVFEDINLPGKWKPKMIGGIGGFMKVREYDQVP
IEICGHKTIGSVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006