<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1233 1233-30409 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M   L10I, T12P, I13IV, I15V, K20T, E35D, N37S, R41K, L63P, A71T  
>1233-30409| codons 4-99
TLWQRPIVPVKVGGQLTEALLDTGADDTVLEDMSLPGKWKPKIIGGIGGFVKVRQYDQIP
IEICGHKTIGTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215F   G190A   V60I, K101Q, V118I, D121Y, K122E, I135T, S162A, D177E, V179I, R211K, D237E, V245Q  
>1233-30409| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAYFSIPLYEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKQNPEIIIYQYVDDLYVASDLEIGQHRTKIEELRQHLWKWGFFTP
DKKHQKEPPFLWMGYELHPEKWTVQPIQLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006