<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2330 2330-30811 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46MI, I47IV, I54L, I84V, L90M L10F, L33F, G73GS, L89V I13V, K14R, K20KT, R41RK, I66IF, A71V, T91TS  
>2330-30811| codons 4-99
TLWQRPFVTVRIGGQLTEALLDTGADDTIFEEMNLPGKWKPKIVGGIGGFLKVRQYDQIL
IEFCGHKVISTVLVGPTPVNVIGRNVMSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70KR, L74V, M184V, T215FS D67DH, K219Q Y181YFIN, G190CS   V60I, T69TN, K122E, I135T, F214L, D218DE, Q242QL  
>2330-30811| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKHSNRWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVINQYVDDLYVSSDLEIGQHRTKIEELRQHLLRWGLSTP
EQKHQKEPPFLWMGYELHPDKWTVLPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006