<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2329 2329-30804 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, I84V, L90M L33F, K43T, G73C L10I, G16A, I62V, L63P, I64IV, I72IKLQ, V77I, P79N, I93IL  
>2329-30804| codons 4-99
TLWQRPIVTIKIAGQLKEALLDTGADDTIFEEMNLPGRWTPKIVGGIGGFLKVRQYDQVP
VEICGHKAQCTVLIGNTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219KR     K43Q, E44D, V118I, K122E, S162D, D177DG, G196E, T200A, H208Y V111VIM
>2329-30804| codons 38-246
CTELEQDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDMGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQDSMTKILEPFRKQNPGIVIYQYVDDLYVGSDLEIEQHRAKIEELRQYLWRWGFYTP
DRKHQKEPPFLWMGYELHPDKWTVQPIVL

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006