<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2297 2297-30812 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54AV, V82A, I84V L10F, L89V V11L, I13V, L19Q, K20I, M36I, L63P, H69K, K70R, A71T, T74S, T91S  
>2297-30812| codons 4-99
TLWQRPFLTVKIGGQQIEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFVKVRQYDQIP
IEICGKRTIGSVLVGPTPANVIGRNVLSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215I, K219E K103KN, G190A   M41MI, V60I, K102N, V106I, K122KE, D123E, K173T, Q174QK, D177DE, T200A  
>2297-30812| codons 38-247
CTEIEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKNNKSITVLDVGDAYFSVPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRTKNPEIVIYQYVDDLYVASDLEIGQHRAKIEELRQHLLRWGFITP
DEKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006