<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2208 2208-30722 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   K103N, Y181C V108VI D123E, I135V, D177E, V189I, T200A, E203K, L228H  
>2208-30722| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTILDVGDAYFSVPLDKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVICQYMDDLYIGSDLEIGQHRAKIKELRQHLWRWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I50V, I54L L24I, L33F, F53L, G73CS L10I, I13V, E34Q, N37A, I64V, A71V, I72V, V77I, V82I  
>2208-30722| codons 5-99
LWQRPIVTVKIGGQLKEALIDTGADDTIFQEMALPGRWKPKIVGGVGGLLKVRQYDQILV
EICGHKVVSTVLIGPTPINIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006