<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2207 2207-30715 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M K43T, F53FL L10I, T12D, I15V, K20R, M36I, D60E, I62IV, L63P, A71V, I93L L5H
>2207-30715| codons 4-99
THWQRPIVDIKVGGQLREALLDTGADDTVLEEINLPGRWTPKMIGGIGGLVKVRQYEQVP
IEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184V, L210W, T215Y F77FL     K43E, E44A, E53EQ, V118I, K122E, I135K, T139TS, I142IMT, K173Q, G196E, R211K, V245E  
>2207-30715| codons 38-247
CTELEEAGKISKIGPQNPYNTPVFAIKKKNSTKWRKLMDLRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSKNNESPGTRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRQQNPDIVIYQYVDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006