<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1538 1538-30616 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, V82A, L90M L10F, L33F, K43T I13V, E34Q, N37E, L63A, A71V, V77I  
>1538-30616| codons 4-99
TLWQRPFVTVKIGGQLKEALLDTGADDTIFQEMELPGRWTPKIVGGIGGFMKVRQYDQIA
IEICGHKVIGTVLIGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, T215F K219W K101KDEN, Y181C, G190A V108I K43KN, K103KR, T139TI, S162C, V189I, H208Y, R211K, D218E K65K_N
>1538-30616| codons 38-247
CTELENEGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLNKRKSVTILDVGDAYFSVPLDKDFRKYTAFTIPSINNEIPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVICQYMDDLYIASDLEIGQHRTKIEELRQYLLKWGFFTP
EWKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006