<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1208 1208-30507 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, V75M, M184V, L210W, T215Y   K103N A98G, V108VI T39D, K82R, K122E, I135L, K173N, Q174K, D192N, Q207E  
>1208-30507| codons 38-247
CDELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVMDFRELNRRTQDFWEVQLGIPHP
GGLKKNKSVTILDVGDAYFSVPLDEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRNKNPDIVIYQYVDDLYVGSNLEIGQHRTKIEELREHLWRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L33I, K43T, F53L L10I, G16E, K20R, E35D, M36I, N37NI, K55R, R57K, D60E, I62IV, L63T, I64V, A71V, I85V, Q92K, I93L  
>1208-30507| codons 4-99
TLWQRPIVTIKIEGQLREALLDTGADDTVIEDIILPGRWTPKLIGGIGGLVRVKQYEQVT
VEICGHKVIGTVLVGPTPANIVGRNLMTKLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006