<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1199 1199-30225 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69S_SS, M184V, T215Y A62V, V75VL K103N V108I K122E, D123N, I135T, E138Q, K173R, Q207E, L210S, R211K I159IK
>1199-30225| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKDSSKWRKLLDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTILDVGDAYFSVPLDENFRKYTAFTIPSTNNQTPGIRYQYNVLPQGWKGSP
AKFQSSMTKILEPFRRQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELREHLSKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48L, I50V, I54T, V82A   L10I, I15V, G16A, N37S, L63P, A71T, V77I, I85V, Q92K  
>1199-30225| codons 4-99
TLWQRPIVTIKVAGQLKEALLDTGADDTVLEEMSLPGRWKPKMILGVGGFTKVRQYDQIP
IEICGHKTIGTVLIGPTPANIVGRNLLTKIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006