<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2440 2440-30818 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54LV, V82A, L90M L10F, L33LF, K43T I13IV, K20R, E35D, M36I, N37T, I62V, L63P, H69HQ, K70KE, A71V, I93L  
>2440-30818| codons 4-99
TLWQRPFVTVKIGGQLREALLDTGADDTVFEDITLPGRWTPKMIGGIGGFVKVRQYDQVP
IEICGQEVIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, T69D, K70KR, M184V, L210W, T215Y K219R K103KN   K43KE, E44A, K49KR, K101Q, V118VI, K122E, E203EK, Q207QDEH, H208HY, R211RK, K223KE  
>2440-30818| codons 38-247
CTEMEEAGKISRIGPENPYNTPVFAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLQKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIKELRHYLWKWGFYTP
DRKHQEEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006