<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1685 1685-30327 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, I84V, L90M L10FI, L33F, Q58E T12S, I13V, G16GA, L19I, K20R, M36L, L63P, I64V, I66V, H69R, Q92K, I93L, C95F  
>1685-30327| codons 4-99
TLWQRPIVSVKIAGQIREALLDTGADDTVFEELNLPGRWKPKIIGGIGGFVKVREYDQIP
VEVCGRKAIGTVLVGPTPANVIGRNLMTKLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, T215Y K219N K103N, Y181YC, G190GA V108VI E44D, K64KR, K102R, V118I, D123E, I135T, D177E, I178M, L210S, V245T  
>1685-30327| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIRKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKRNKSVTILDVGDAYFSIPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEMVICQYVDDLYVASDLEIGQHRTKIEELRQHLSRWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006