<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2384 2384-30815 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V L10F, N83D, N88D I13V, G16A, A22V, E34Q, N37ND, R57K, L63P, A71V, T91A  
>2384-30815| codons 4-99
TLWQRPFVTVKIAGQLKEVLLDTGADDTVLQEMDLPGRWKPKIIGGIGGFIKVKQYDQIP
IEICGHKVIGTVLVGPTPVDVIGRDLLAQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y       K43E, K49R, E53D, V118I, K122E, S162H, H208Y, R211K  
>2384-30815| codons 38-247
CTELEEEGKISRIGPDNPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQHSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006