<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2113 2113-30819 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y A62V, V75I, K219N L100I, K103N   K43E, A98S, V118I, K122E, I135V, H208Y, L228H, V245E  
>2113-30819| codons 38-247
CTELEEEGKISKIGPENPYNTPVFVIKKKNSTKWRKLIDFRELNKRTQDFWEVQLGIPHP
SGIKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQYLWRWGFYTP
DNKHQKEPPFHWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54L, I84V, L90M G73C L10I, T12P, I13V, I15V, K20I, E35E_G, M36I, R41K, D60E, Q61D, I62V, L63P, C67Y T31I
>2113-30819| codons 4-99
TLWQRPIVPVKVGGQLIEALLDTGADDIVLEEINLPGKWKPKIVGGIGGFLKVRQYEDVP
IEIYGHKAICTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006