<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2112 2112-30813 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54L, V82A, I84V   L10H, I13V, L19V, K20I, I62V, L63T, I64V, T74S, T91A V11P
>2112-30813| codons 4-99
TLWQRPHPTVKIGGQVIEALLDTGADDTVLEEMNLPGRWKPKLIVGIGGFLKVRQYDQVT
VEICGHKAIGSVLVGPTPANVIGRNLLAQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219W L100I, K103N A98G V60I, T69H, V118I, K122E, I135T, Q174QK, D177E, G196E, T200I, I202V, H208Y, D218E, E224D, L228H S68I
>2112-30813| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNIHRWRKLVDFRELNKRTQDFWEVQLGIPHP
GGIKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKKNPEIVIYQYVDDLYVGSDLEIEQHRIKVEELRQYLLRWGFFTP
EWKHQKDPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006