<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2110 2110-30709 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, I84V V11VI, L24I, L33F L10V, I13V, K14R, I15V, L19LP, K20T, E35D, M36V, R41K, L63P, I64V, A71V, V77I, I93L  
>2110-30709| codons 4-99
TLWQRPVITVRVGGQPTEALIDTGADDTVFEDVNLPGKWKPKLIGGIGGFVKVRQYDQIP
VEICGHKVIGTVLIGPTPVNVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y V75VA, K219R   F227FL K43KQ, E44D, V118I, K122E, I135T, E203K, Q207E, H208Y, R211K, K223E, V245K V106T
>2110-30709| codons 38-246
CTELEQDGKISKIGPENPYNTPVFAIKKKNSTKWRKVADFRELNKRTQDFWEVQLGIPHP
AGLKKKKSTTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIKELREYLWKWGFYTP
DRKHQEEPPLLWMGYELHPDKWTVQPIKL

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006