<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1530 1530-30807 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82T, L90M G73S L10I, E35D, M36I, N37E, I62V, L63P, C67F, A71I, I72K  
>1530-30807| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEDIELPGRWKPKMIGGIGGFVKVRQYDQVP
IEIFGHKIKSTVLVGPTPTNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, T69D D67G Y181C   V60I, R83K, V118I, G196E, E203D, E204K, Q207E, F214L  
>1530-30807| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKRKGSDKWRKLVDFRELNKKTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIEQHRTKIDKLREHLLRWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006