<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2324 2324-30724 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82F, I84V, L90M Q58E L10I, L19IT, K20R, E35D, M36I, K55R, D60E, I62IV, L63P  
>2324-30724| codons 4-99
TLWQRPIVTIKIGGQTREALLDTGADDTVLEDINLPGRWKPKIIGGIGGFVRVREYEQVP
IEICGHKAIGTVLVGPTPFNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219N Y188L   K43E, E44A, V118I, K122E, I142IV, S162SA, V179I, T200A, E203K, H208Y, R211K, K223E, L228H  
>2324-30724| codons 38-247
CTELEEAGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKQNPDIIIYQYVDDLLVGSDLEIGQHRAKIKELRQYLWKWGFYTP
DNKHQEEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006