<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2203 2203-30708 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, I47IV, I54IV, I84V, L90M G73T L10I, K20R, E35D, M36I, N37T, L38LM, I62V, L63P, A71IV, V77I, I93L  
>2203-30708| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTILEDITMPGRWKPKMVGGIGGFVKVRQYDQVP
IEICGHKVITTVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, M184MV, L210W, T215Y K219R   P225PH K43Q, K82KR, A98S, V118I, K122E, V189VI, E203D, R211K, L228H  
>2203-30708| codons 38-247
CTELEQEGKISKIGPENPYNTPVFAIKKKDSDKWRKLVDFRELNRRTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYIGSDLEIGQHRTKIDELRQHLWKWGFYTP
DRKHQKEHPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006