<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2300 2300-30819 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V, T215F K219Q K103N, Y181YC A98G V60I, V90I, I135T, S162W, V179VI, T200K, Q207E, R211K, F214FL, D218E, L228H  
>2300-30819| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSDRWRKLVDFRELNKRTQDFWEIQLGIPHP
GGLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQWSMTKILEPFRKQNPDIIICQYVDDLYVGSDLEIGQHRKKIEELREHLLKWGLFTP
EQKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, I84V L24I, L33F L10I, T12P, N37S, K55R, I62IV, L63P, K70T, A71V, V77I  
>2300-30819| codons 4-99
TLWQRPIVPIKIGGQLKEALIDTGADDTVFEEMSLPGRWKPKLIGGIGGFVRVRQYDQVP
IEICGHTVIGTVLIGPTPVNVIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006