<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2234 2234-31205 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 19

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82T, L90M N88D L10I, I15V, K20R, E35D, M36I, N37D, I62V, L63P, A71V, F99Y  
>2234-31205| codons 1-99
PQITLWQRPIVTIKVGGQLREALLDTGADDTVLEDIDLPGRWKPKLIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLVGPTPTNIIGRDLMTQIGCTLNY

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219E Y188L F227FL E44D, W88WC, V118I, K122E, D123E, R172K, D177E, I178L, E194N, G196E, I202V, E203EK, H221Y, A272P, K277R, E297K, S322T, I326V, G333E, Q334N, G335S, R356K, R358RK, S379C  
>2234-31205| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPELVI
YQYVDDLLVGSDLNIEQHRTKVKELRQHLWRWGFYTPDEKYQKEPPLLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQENSQWTYQIYQEPFKNLKTGKYAKMKGA
HTNDVKQLTEAVQKIATECIVIWGKTPKFKLPIQKETWEA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006