<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
143P11 143P11W72 U.S. 1993 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 40
2 DDI 72

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, L74V K219KQ     D121H, K122E, I142V, R172X, Q174X, I178M, V179I, R211K, K238X  
>143P11W72| codons 26-240
LTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKRKDSTRWRKVVDFRELNKRTQ
DFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSINNETPGVRYQ
YNVLPQGWKGSPAIFQSSMTKILEPFXKXNPDMIIYQYMDDLYVGSDLEIGQHRTKIEEL
RQHLLKWGFTTPDQKHQKEPPFLWMGYELHPDXWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    W6X, Q7X, E35D, K45Q, L63P  
>143P11W72| codons 1-99
PQITLXXRPLVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPQMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Winters, MA Human immunodeficiency virus type 1 reverse transcriptase genotype and drug susceptibility changes in infected individuals receiving dideoxyinosine monotherapy for 1 to 2 years. AAC, 1997
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005