<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1762 1762-30417 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82C, I84V, L90M V11VI, L33F, T74P L10I, I13V, R41K, I62V, L63P, A71T, I93L L89R
>1762-30417| codons 4-99
TLWQRPIITVKIGGQLKEALLDTGADDTVFEEMNLPGKWKPKLIGGIGGFVKVRQYDQVP
IEICGHKTIGPVLVGPTPCNVIGRNRMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_SS, V75M, M184MV, L210W, T215Y   K103S, G190A V108I T39A, D86E, W88C, L109I, D123E, I142V, R172K, V179I, Q197K, T200A, Q207E, H221Y  
>1762-30417| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIKKKDSSKWRKLMDFRELNKRTQEFCEVQLGIPHP
AGLKKSKSVTIIDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFKKQNPDIIIYQYVDDLYVASDLEIGKHRAKIEELREHLWRWGFYTP
DKKYQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006