<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2437 2437-30820 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M A62V, K70S, V75I, F116Y K101E, Y181C, G190A V108I S68N, V90I, V118VI, K122E, D123E, I135IR, T139TA, T165I, T200A, Q207E, F214L  
>2437-30820| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKDNTSWRKLIDFRELNKRTQDFWEIQLGIPHP
AGLEKKKSVTILDVGDAYYSIPLDEEFRKYTAFTIPSRNNEAPGIRYQYNVLPMGWKGSP
AIFQSSMIKILEPFRKQNPDIVICQYMDDLYVASDLEIGQHRAKIEELREHLLRWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54M, I84V, L90M L10FY, G73C K20I, E34Q, M36I, R41K, K43E, Q61N, I62V, L63P, I64V, C67W, I72T, P79A, I85V, Q92K, I93L D60EGKR
>2437-30820| codons 4-99
TLWQRPYVTIKIGGQLIEALLDTGADDTVLQEINLPGKWEPKMIGGIGGFMKVRQYRNVP
VEIWGHKATCTVLVGATPVNVVGRNLMTKLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006