<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1486 1486-30819 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, M46L, I54LV, L90M L33F, G73IS L10I, I15V, K20R, E35D, M36I, R41K, I62V, L63P, K70E, A71V, I93L I13S
>1486-30819| codons 4-99
TLWQRPIVTSKVGGQLREALLDTGADDTIFEDINLPGKWKPKLIGGIGGFVKVRQYDQVP
IEICGHEVISTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219R K103N   V60VI, V90VI, V118I, K122E, I135T, Q174R, I178IL, E203EK, Q207DE, H208HY, R211K  
>1486-30819| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPDLVIYQYMDDLYVGSDLEIGQHRTKIKELREYLWKWGFYTP
DRKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006