<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1481 1481-30812 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y   V106A, G190A F227L E44D, E53D, V118I, K122E, I195T, E203K, H208Y, R211Q, K223E  
>1481-30812| codons 38-247
CTELEKDGKISKIGPDNPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSATVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVASDLETGQHRTKIKELRQYLWQWGFYTP
DKKHQEEPPLLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54V, L90M L10F, N88D E35D, M36I, N37S, R41K, I62V, L63P, A71T, I72M, I93L  
>1481-30812| codons 4-99
TLWQRPFVTIKIGGQLKEALLDTGADNTVLEDISLPGKWKPKMIGGIGGFVKVRQYDQVP
IEICGHKTMGTVLVGPTPVNIIGRDLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006