<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2480 2480-30822 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D, K70R, M184V, T215FV D67G, K219Q K103N, Y181C   K64H, V118I, I135T, T200A, Q207E, F214L, L228HR, V245T  
>2480-30822| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIHKKGSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGLVTP
DQKHQKEPPFRWMGYELHPDKWTVQPITLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I54V, V82A, L90M L33F, F53L L10V, I13V, I15V, M36ML, R41N, L63P, K70R, A71V  
>2480-30822| codons 4-99
TLWQRPVVTVKVGGQLKEALLDTGADDTIFEELNLPGNWKPKIIGGIGGLVKVRQYDQIP
IEICGHRVIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006