<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1285 1285-30311 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54L, L76V, I84V, L90M N83D L10I, K20R, E34Q, R41K, D60E, I62V, L63P, A71V, I93L M36D_*
>1285-30311| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTVLQEDNLPGKWKPKIIGGIGGFLKVRQYEQVP
IEICGHKVIGTVVVGPTPVDVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V, T215F D67S, K219E L100I, K103N   I50V, T69N, K122E, I135T, Q174R, T200A, R211G, F214L, L228H, V245K  
>1285-30311| codons 38-247
CTEMEKEGKISKVGPENPYNTPVFAIKKKSSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLGWGLFTP
DEKHQKEPPFHWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006