<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1463 1463-30603 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215Y K219E Y181YC K101H T39TA, V118VI, K122E, D123S, I135T, E169D, V179I, I202V, H208Y, L228LHR  
>1463-30603| codons 38-247
CAEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLHKKKSVTVLDVGDAYFSIPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILDPFRKQNPDIIICQYVDDLYVGSDLEIGQHRTKVEELRQYLLRWGFYTP
DEKHQKEPPFRWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, L90M   L10I, T12K, L19I, K20I, E34Q, N37S, R41RK, L63P, C67CF, H69HQ, I72IL, V77I G73I
>1463-30603| codons 4-99
TLWQRPIVKIKIGGQIIEALLDTGADDTILQEMSLPGKWKPKIVGGIGGFMKVRQYDQIP
IEIFGQKALITVLIGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006