<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1720 1720-30520 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y   K103N, Y181C   T39E, S68G, V111I, K122E, I135T, K166R, I178LM, V179VI, G196E, T200TAIV, H208Y, R211K, L228H  
>1720-30520| codons 38-247
CEELEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDIGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDMIICQYVDDLYVGSDLEIEQHRVKIEELRQYLWKWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M L10F, V11I, F53L, G73C T12P, I15V, L19P, K20I, E35D, M36I, N37E, I62V, L63P, I64V, A71V, I72IT, T74S, I85V, T91S, I93L  
>1720-30520| codons 4-99
TLWQRPFIPIKVGGQPIEALLDTGADDTVLEDIELPGRWKPKIIGGIGGLIKVRQYDQVP
VEICGHKVTCSVLVGPTPVNVVGRNLMSQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006