<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2391 2391-30813 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46MI, I47IV, I54IL, I84IV, L90M Q58E I15IV, G16E, K20R, E35D, M36I, N37E, L63P, A71V, P79PH, I93L  
>2391-30813| codons 4-99
TLWQRPLVTIKVEGQLREALLDTGADDTILEDIELPGRWKPKIVGGIGGFLKVREYDQIP
IEICGHKVIGTVLVGHTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74LV, M184MV, L210W, T215Y K219N K103KN   E44D, V60I, W88C, V118I, L120*, K122E, D123N, D177E, G196E, E203K, Q207D, H208Y, R211K  
>2391-30813| codons 38-247
CTELEKDGKISKIGPENPYNTPIFAIKKKNSTKWRKVVDFRELNKRTQDFCEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIP*DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIEQHRTKIKELRDYLWKWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006