<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2233 2233-30805 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, V82A, I84V   L10I, G16E, I62V, L63CS, A71V, I93L  
>2233-30805| codons 4-99
TLWQRPIVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKIIVGIGGFIKVRQYDQVS
IEICGHKVIGTVLVGPTPANVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y       E44D, K102Q, V118VI, D123E, K166Q, D177E, I178L, G196GE, I202V, R211K, V245T  
>2233-30805| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKQKKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTQILEPFRKQNPELVIYQYVDDLYVGSDLEIEQHRTKVEELRQHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006