<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2232 2232-30715 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M T74P L10I, I13V, K14KR, I15V, Q18K, K20I, M36I, R41K, K55KR, D60E, Q61D, L63P, A71V, I93L  
>2232-30715| codons 4-99
TLWQRPIVTVRVGGKLIEALLDTGADDTVLEEINLPGKWKPKIIGGIGGFVRVRQYEDIP
IEICGHKVIGPVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y   K101E, Y181C, G190AS   K122E, T165I, E169D, G196E, I202IV, V245Q  
>2232-30715| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMIKILDPFRKQNPDIVICQYMDDLYVSSDLEIEQHRTKVEELRQHLWRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006