<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2102 2102-30701 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, L210W, T215Y K219R V106A F227L K43KN, E44D, V111I, V118I, K122E, D177E, I178M, T200S, E203K, Q207E, H208Y, R211K  
>2102-30701| codons 38-247
CTELENDGKISKIGPENPYNTPVFAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSATVLDIGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEMVIYQYMDDLYVGSDLEIGQHRSKIKELREYLWKWGFYTP
DRKHQKEPPLLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L10F, L24I, L33F, K43T I13V, E35D, M36I, N37D, K55KR, R57K, Q61QH, I62V, L63PQ, A71V, I93L  
>2102-30701| codons 4-99
TLWQRPFVTVKIGGQLKEALIDTGADDTVFEDIDLPGRWTPKIIGGIGGFVRVKQYDHVQ
IEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006