<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1142 1142-30401 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, L90LM N88D I13V, I62IMV, L63PS, A71AITV, V77I  
>1142-30401| codons 4-99
TLWQRPLVTVKIGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQVS
IEICGHKVIGTVLIGPTPVNIIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V, T215F K219Q Y181C V108I K102Q, D121H, K122E, K166T, I202V, R211K, H221Y  
>1142-30401| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKQKKSVTILDVGDAYFSVPLHEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTTILEPFRKQNPDIVICQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGFFTP
DQKYQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006